Tbx4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2136107
Article Name: Tbx4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136107
Supplier Catalog Number: orb2136107
Alternative Catalog Number: BYT-ORB2136107-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Tbx4
Conjugation: Biotin
Tbx4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 001100504
UniProt: D4A0A2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DKGLSESEEAFRAPGPALGETSNSNNTNVPEPALATPGLSGTALSSPPGQ