TOX Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2136161
Article Name: TOX Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136161
Supplier Catalog Number: orb2136161
Alternative Catalog Number: BYT-ORB2136161-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TOX
Conjugation: Biotin
Alternative Names: TOX1
TOX Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 055544
UniProt: O94900
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CLDPYYCNKFDGENMYMSMTEPSQDYVPASQSYPGPSLESEDFNIPPITP