ZNF92 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2136219
Article Name: ZNF92 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136219
Supplier Catalog Number: orb2136219
Alternative Catalog Number: BYT-ORB2136219-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZNF92
Conjugation: HRP
Alternative Names: TF12, HPF12, HTF12, HEL-203
ZNF92 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 60kDa
UniProt: Q03936
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: TLTKHKRIHTGEKPYKCEECGKAFKQSSTLTEHKIIHTGEKPYKCEKCGK