LHX3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2136237
Article Name: LHX3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136237
Supplier Catalog Number: orb2136237
Alternative Catalog Number: BYT-ORB2136237-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human LHX3
Conjugation: HRP
Alternative Names: LIM3, CPHD3, M2-LHX3
LHX3 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 055379
UniProt: Q9UBR4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QNRRAKEKRLKKDAGRQRWGQYFRNMKRSRGGSKSDKDSVQEGQDSDAEV