ZNF703 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2136241
Article Name: ZNF703 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136241
Supplier Catalog Number: orb2136241
Alternative Catalog Number: BYT-ORB2136241-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF703
Conjugation: FITC
Alternative Names: NLZ1, ZPO1, ZEPPO1, ZNF503L
ZNF703 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 58kDa
NCBI: 079345
UniProt: Q9H7S9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LSRYHPYGKSHLSTAGGLAVPSLPTAGPYYSPYALYGQRLASASALGYQ