ZNF606 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2136296
Article Name: ZNF606 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136296
Supplier Catalog Number: orb2136296
Alternative Catalog Number: BYT-ORB2136296-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF606
Conjugation: Biotin
Alternative Names: ZNF328
ZNF606 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 92kDa
NCBI: 079303
UniProt: Q8WXB4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: WHVEGSLEEGRRATGLPAAQVQEPVTFKDVAVDFTQEEWGQLDLVQRTLY