ZNF426 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2136377
Article Name: ZNF426 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136377
Supplier Catalog Number: orb2136377
Alternative Catalog Number: BYT-ORB2136377-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF426
Conjugation: Biotin
Alternative Names: K-RBP
ZNF426 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 077011
UniProt: Q9BUY5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VMLENYKNLATVGGQIIKPSLISWLEQEESRTVQGGVLQGWEMRLETQWS