ZNF236 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2136392
Article Name: ZNF236 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136392
Supplier Catalog Number: orb2136392
Alternative Catalog Number: BYT-ORB2136392-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF236
Conjugation: Biotin
Alternative Names: ZNF236A, ZNF236B
ZNF236 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 204kDa
NCBI: 031371
UniProt: Q9UL36
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VSATGETEGGDICMEEEEEHSDRNASRKSRPEVITFTEEETAQLAKIRPQ