ZNF202 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2136413
Article Name: ZNF202 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2136413
Supplier Catalog Number: orb2136413
Alternative Catalog Number: BYT-ORB2136413-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF202
Conjugation: Biotin
Alternative Names: ZSCAN42, ZKSCAN10
ZNF202 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 75kDa
NCBI: 003446
UniProt: O95125
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ATAVEPEDQDLWEEEGILMVKLEDDFTCRPESVLQRDDPVLETSHQNFRR