DBI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2137664
Article Name: DBI Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2137664
Supplier Catalog Number: orb2137664
Alternative Catalog Number: BYT-ORB2137664-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DBI
Conjugation: Biotin
Alternative Names: EP, ACBP, ACBD1, CCK-RP
DBI Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 001073331
UniProt: P07108
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MSQAEFEKAAEEVRHLKTKPSDEEMLFIYGHYKQATVGDINTERPGMLDF