ENG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2137899
Article Name: ENG Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2137899
Supplier Catalog Number: orb2137899
Alternative Catalog Number: BYT-ORB2137899-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ENG
Conjugation: Biotin
Alternative Names: END, HHT1, ORW1
ENG Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 68kDa
NCBI: 000109
UniProt: P17813
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ILEVHVLFLEFPTGPSQLELTLQASKQNGTWPREVLLVLSVNSSVFLHLQ