PPARA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2137906
Article Name: PPARA Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2137906
Supplier Catalog Number: orb2137906
Alternative Catalog Number: BYT-ORB2137906-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the n terminal region of human PPARA
Conjugation: Biotin
Alternative Names: PPAR, NR1C1, hPPAR, PPARalpha, PPAR-alpha
PPARA Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 51kDa
NCBI: 005027
UniProt: Q07869
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FTEYQYLGSCPGSDGSVITDTLSPASSPSSVTYPVVPGSVDESPSGALNI