ZNF232 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2138247
Article Name: ZNF232 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138247
Supplier Catalog Number: orb2138247
Alternative Catalog Number: BYT-ORB2138247-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF232
Conjugation: Biotin
Alternative Names: ZSCAN11
ZNF232 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 44kDa
UniProt: Q9UNY5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YECNECGKAFSQSSYLSQHRRIHSGEKPFICKECGKAYGWCSELIRHRRV