GATAD2B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2138271
Article Name: GATAD2B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138271
Supplier Catalog Number: orb2138271
Alternative Catalog Number: BYT-ORB2138271-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human GATAD2B
Conjugation: Biotin
Alternative Names: p68, GANDS, MRD18, P66beta
GATAD2B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 65kDa
NCBI: 065750
UniProt: Q8WXI9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HELPTKQDGSGVKGYEEKLNGNLRPHGDNRTAGRPGKENINDEPVDMSAR