JMJD1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2138356
Article Name: JMJD1A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138356
Supplier Catalog Number: orb2138356
Alternative Catalog Number: BYT-ORB2138356-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human JMJD1A
Conjugation: Biotin
Alternative Names: TSGA, JMJD1, JHDM2A, JHMD2A, JMJD1A
JMJD1A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 147kDa
NCBI: 060903
UniProt: Q53S72
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HNLYSCIKVAEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIY