HR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2138374
Article Name: HR Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138374
Supplier Catalog Number: orb2138374
Alternative Catalog Number: BYT-ORB2138374-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human HR
Conjugation: Biotin
Alternative Names: AU, MUHH, ALUNC, HYPT4, MUHH1, HSA277165
HR Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 127kDa
NCBI: 005135
UniProt: O43593
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GLPPEHPCDWPLTPHPWVYSGGQPKVPSAFSLGSKGFYYKDPSIPRLAKE