C14ORF131 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2138386
Article Name: C14ORF131 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138386
Supplier Catalog Number: orb2138386
Alternative Catalog Number: BYT-ORB2138386-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C14ORF131
Conjugation: Biotin
Alternative Names: C14orf131
C14ORF131 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 46kDa
NCBI: 060805
UniProt: Q9Y595
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KMCQDYLSSSGLCSQETLEINNDKVAESLGITEFLRKKEIHPDNLGPKHL