DLX5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2138499
Article Name: DLX5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138499
Supplier Catalog Number: orb2138499
Alternative Catalog Number: BYT-ORB2138499-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human DLX5
Conjugation: FITC
Alternative Names: SHFM1, SHFM1D
DLX5 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 31kDa
NCBI: 005212
UniProt: P56178
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KEVTEPEVRMVNGKPKKVRKPRTIYSSFQLAALQRRFQKTQYLALPERAE