DLX1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2138505
Article Name: DLX1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138505
Supplier Catalog Number: orb2138505
Alternative Catalog Number: BYT-ORB2138505-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human DLX1
Conjugation: FITC
DLX1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 835221
UniProt: P56177
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KFKKLMKQGGAALEGSALANGRALSAGSPPVPPGWNPNSSSGKGSGGNAG