BAZ1A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2138557
Article Name: BAZ1A Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138557
Supplier Catalog Number: orb2138557
Alternative Catalog Number: BYT-ORB2138557-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human BAZ1A
Conjugation: HRP
Alternative Names: ACF1, WALp1, hACF1, WCRF180
BAZ1A Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 179kDa
NCBI: 038476
UniProt: Q9NRL2
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SLPKRGRPQVRLPVKTRGKLSSSFSSRGQQQEPGRYPSRSQQSTPKTTVS