WDHD1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2138563
Article Name: WDHD1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138563
Supplier Catalog Number: orb2138563
Alternative Catalog Number: BYT-ORB2138563-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDHD1
Conjugation: HRP
Alternative Names: AND1, CTF4, AND-1, CHTF4
WDHD1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 126kDa
NCBI: 009017
UniProt: O75717
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: KQILHGDPLPLTRKSYLAWIGFSAEGTPCYVDSEGIVRMLNRGLGNTWTP