MYST2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2138571
Article Name: MYST2 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138571
Supplier Catalog Number: orb2138571
Alternative Catalog Number: BYT-ORB2138571-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MYST2
Conjugation: FITC
Alternative Names: HBO1, HBOA, MYST2, ZC2HC7
MYST2 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 71kDa
NCBI: 008998
UniProt: O95251
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MPRRKRNAGSSSDGTEDSDFSTDLEHTDSSESDGTSRRSARVTRSSARLS