MORF4L1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Catalog Number:
BYT-ORB2138629
| Article Name: |
MORF4L1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2138629 |
| Supplier Catalog Number: |
orb2138629 |
| Alternative Catalog Number: |
BYT-ORB2138629-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human MORF4L1 |
| Conjugation: |
HRP |
| Alternative Names: |
Eaf3, MEAF3, MRG15, FWP006, S863-6, HsT17725, MORFRG15 |
| MORF4L1 Rabbit Polyclonal Antibody (HRP) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
40kDa |
| UniProt: |
Q86YT7 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: YAVNEVVAGIKEYFNVMLGTQLLYKFERPQYAEILADHPDAPMSQ |
