PPP1R13L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2138651
Article Name: PPP1R13L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138651
Supplier Catalog Number: orb2138651
Alternative Catalog Number: BYT-ORB2138651-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PPP1R13L
Conjugation: Biotin
Alternative Names: RAI, RAI4, IASPP, NKIP1
PPP1R13L Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 89kDa
NCBI: 006654
UniProt: Q8WUF5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: AQSVPELEEVARVLAEIPRPLKRRGSMEQAPAVALPPTHKKQYQQIISRL