ACDC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2138724
Article Name: ACDC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138724
Supplier Catalog Number: orb2138724
Alternative Catalog Number: BYT-ORB2138724-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACDC
Conjugation: Biotin
Alternative Names: ACDC, ADPN, APM1, APM-1, GBP28, ACRP30, ADIPQTL1
ACDC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 27kDa
NCBI: 004788
UniProt: Q15848
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KGDIGETGVPGAEGPRGFPGIQGRKGEPGEGAYVYRSAFSVGLETYVTIP