FSBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2138791
Article Name: FSBP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2138791
Supplier Catalog Number: orb2138791
Alternative Catalog Number: BYT-ORB2138791-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human FSBP
Conjugation: Biotin
Alternative Names: RDH54
FSBP Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 17kDa
NCBI: 33710
UniProt: O95073
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DPQILQMLKEEHQIILENQKNFGLYVQEKRDGLKRRQQLEEELLRAKIEV