CNOT2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2139038
Article Name: CNOT2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139038
Supplier Catalog Number: orb2139038
Alternative Catalog Number: BYT-ORB2139038-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human CNOT2
Conjugation: Biotin
Alternative Names: NOT2, CDC36, NOT2H, HSPC131, IDNADFS
CNOT2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 055330
UniProt: Q9NZN8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PLAGRAPYVGMVTKPANEQSQDFSIHNEDFPALPGSSYKDPTSSNDDSKS