NFATC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2139069
Article Name: NFATC4 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139069
Supplier Catalog Number: orb2139069
Alternative Catalog Number: BYT-ORB2139069-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NFATC4
Conjugation: Biotin
Alternative Names: NFAT3, NF-AT3, NF-ATC4
NFATC4 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 95kDa
NCBI: 004545
UniProt: Q14934
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTV