TRIM23 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2139234
Article Name: TRIM23 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139234
Supplier Catalog Number: orb2139234
Alternative Catalog Number: BYT-ORB2139234-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TRIM23
Conjugation: Biotin
Alternative Names: ARD1, ARFD1, RNF46
TRIM23 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 150231
UniProt: P36406
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KHSVLEPEANQIRASILDMAHCIRTFTEEISDYSRKLVGIVQHIEGGEQI