APEX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2139321
Article Name: APEX1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139321
Supplier Catalog Number: orb2139321
Alternative Catalog Number: BYT-ORB2139321-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human APEX1
Conjugation: Biotin
Alternative Names: APE, APX, APE1, APEN, APEX, HAP1, REF1
APEX1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 35kDa
NCBI: 542379
UniProt: P27695
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KGLDWVKEEAPDILCLQETKCSENKLPAELQELPGLSHQYWSAPSDKEGY