CXXC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2139460
| Article Name: |
CXXC1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2139460 |
| Supplier Catalog Number: |
orb2139460 |
| Alternative Catalog Number: |
BYT-ORB2139460-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the middle region of human CXXC1 |
| Conjugation: |
Biotin |
| Alternative Names: |
CFP1, CGBP, SPP1, PCCX1, PHF18, hCGBP, ZCGPC1, HsT2645, 2410002I16Rik, 5830420C16Rik |
| CXXC1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
76kDa |
| NCBI: |
055408 |
| UniProt: |
Q9P0U4 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: ERIRREQQSARTRLQEMERRFHELEAIILRAKQQAVREDEESNEGDSDDT |
