ZNF777 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2139604
Article Name: ZNF777 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139604
Supplier Catalog Number: orb2139604
Alternative Catalog Number: BYT-ORB2139604-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ZNF777
Conjugation: Biotin
Alternative Names: KIAA1285
ZNF777 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 94kDa
NCBI: 056509
UniProt: Q9ULD5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LPQHLQSLGQLSGRYEASMYQTPLPGEMSPEGEESPPPLQLGNPAVKRLA