TAF5L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2139617
Article Name: TAF5L Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139617
Supplier Catalog Number: orb2139617
Alternative Catalog Number: BYT-ORB2139617-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TAF5L
Conjugation: Biotin
Alternative Names: PAF65B
TAF5L Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 055224
UniProt: O75529
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CVKFHPNSNYLATGSTDKTVRLWSAQQGNSVRLFTGHRGPVLSLAFSPNG