POU2F3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2139743
| Article Name: |
POU2F3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2139743 |
| Supplier Catalog Number: |
orb2139743 |
| Alternative Catalog Number: |
BYT-ORB2139743-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
IHC, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3 |
| Conjugation: |
FITC |
| Alternative Names: |
PLA1, OCT11, PLA-1, Epoc-1, OCT-11, OTF-11, Skn-1a |
| POU2F3 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
47kDa |
| NCBI: |
055167 |
| UniProt: |
Q9UKI9 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR |