POU2F3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2139749
Article Name: POU2F3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139749
Supplier Catalog Number: orb2139749
Alternative Catalog Number: BYT-ORB2139749-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human POU2F3
Conjugation: FITC
Alternative Names: PLA1, OCT11, PLA-1, Epoc-1, OCT-11, OTF-11, Skn-1a
POU2F3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 055167
UniProt: Q9UKI9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KMSGDVADSTDARSTLSQVEPGNDRKGLDFNRQIKTEDLSDSLQQTLSHR