SPDEF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2139766
Article Name: SPDEF Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139766
Supplier Catalog Number: orb2139766
Alternative Catalog Number: BYT-ORB2139766-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human SPDEF
Conjugation: HRP
Alternative Names: PDEF, bA375E1.3
SPDEF Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 37kDa
NCBI: 036523
UniProt: O95238
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: ELCAMSEEQFRQRSPLGGDVLHAHLDIWKSAAWMKERTSPGAIHYCASTS