ZNF318 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2139816
Article Name: ZNF318 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139816
Supplier Catalog Number: orb2139816
Alternative Catalog Number: BYT-ORB2139816-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF318
Conjugation: HRP
Alternative Names: TZF, ZFP318, HRIHFB2436
ZNF318 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 232kDa
NCBI: 055160
UniProt: Q5VUA4
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH