ZC3H7B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2139884
Article Name: ZC3H7B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139884
Supplier Catalog Number: orb2139884
Alternative Catalog Number: BYT-ORB2139884-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ZC3H7B
Conjugation: Biotin
Alternative Names: RoXaN, ROXAN1
ZC3H7B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 110kDa
NCBI: 060060
UniProt: Q9UGR2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YECSSRCSLALPHDESVTQLGQELAQKLGLRVRKAYKRPQELETFSLLSN