EHMT2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Catalog Number:
BYT-ORB2139913
| Article Name: |
EHMT2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2139913 |
| Supplier Catalog Number: |
orb2139913 |
| Alternative Catalog Number: |
BYT-ORB2139913-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
ChIP, WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human EHMT2 |
| Conjugation: |
HRP |
| Alternative Names: |
G9A, BAT8, GAT8, NG36, KMT1C, C6orf30 |
| EHMT2 Rabbit Polyclonal Antibody (HRP) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
132kDa |
| NCBI: |
006700 |
| UniProt: |
Q96KQ7 |
| Buffer: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Form: |
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6. |
| Sequence: |
Synthetic peptide located within the following region: VQSLAMRLLSMPGAQGAAAAGSEPPPATTSPEGQPKVHRARKTMSKPGNG |
