COLEC12 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2139954
Article Name: COLEC12 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2139954
Supplier Catalog Number: orb2139954
Alternative Catalog Number: BYT-ORB2139954-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human COLEC12
Conjugation: FITC
Alternative Names: CLP1, NSR2, SRCL, SCARA4
COLEC12 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 82kDa
NCBI: 569057
UniProt: Q5KU26
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GLGGDGGGCGGGGSGGGGAPRREPVPFPSGSAGPGPRGPRATESGKRMDC