ESRRB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2140901
| Article Name: |
ESRRB Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2140901 |
| Supplier Catalog Number: |
orb2140901 |
| Alternative Catalog Number: |
BYT-ORB2140901-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human ESRRB |
| Conjugation: |
Biotin |
| Alternative Names: |
ERR2, ERRb, ESRL2, NR3B2, DFNB35, ERRbeta2, ERR beta-2 |
| ESRRB Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
55kDa |
| NCBI: |
004443 |
| UniProt: |
O95718 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: SSDASGGFGLALGTHANGLDSPPMFAGAGLGGTPCRKSYEDCASGIMEDS |
