ERF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2140920
Article Name: ERF Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2140920
Supplier Catalog Number: orb2140920
Alternative Catalog Number: BYT-ORB2140920-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ERF
Conjugation: Biotin
Alternative Names: PE2, CRS4, PE-2, CHYTS
ERF Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 86686
UniProt: P50548
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SSSPFKFKLQRPPLGRRQRAAGEKAVAAADKSGGSAGGLAEGAGALAPPP