ZNF449 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2140939
Article Name: ZNF449 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2140939
Supplier Catalog Number: orb2140939
Alternative Catalog Number: BYT-ORB2140939-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human ZNF449
Conjugation: Biotin
Alternative Names: ZSCAN19
ZNF449 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 689908
UniProt: Q6P9G9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GEKPHRCHNCGKSFSRLTALTLHQRTHTEERPFKCNYCGKSFRQRPSLVI