SP7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2141010
Article Name: SP7 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2141010
Supplier Catalog Number: orb2141010
Alternative Catalog Number: BYT-ORB2141010-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human SP7
Conjugation: Biotin
Alternative Names: OSX, OI11, OI12, osterix
SP7 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 690599
UniProt: Q8TDD2
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MASSLLEEEVHYGSSPLAMLTAACSKFGGSSPLRDSTTLGKAGTKKPYSV