ZNF618 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2141016
Article Name: ZNF618 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2141016
Supplier Catalog Number: orb2141016
Alternative Catalog Number: BYT-ORB2141016-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human ZN618
Conjugation: Biotin
Alternative Names: NEDD10, FP13169
ZNF618 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 104kDa
UniProt: Q5T7W0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TLLHRTPPATQTQTFRTPNSGSPASKATAAESAFSRRVEGKAQNHFEETN