EVI1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2142658
Article Name: EVI1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2142658
Supplier Catalog Number: orb2142658
Alternative Catalog Number: BYT-ORB2142658-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human EVI1
Conjugation: Biotin
Alternative Names: EVI1, MDS1, KMT8E, PRDM3, RUSAT2, MDS1-EVI1, AML1-EVI-1
EVI1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 118kDa
NCBI: 005232
UniProt: Q03112
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: HFTDSLKMRKMEDNQYSEAELSSFSTSHVPEELKQPLHRKSKSQAYAMML