ZNF883 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2142734
Article Name: ZNF883 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2142734
Supplier Catalog Number: orb2142734
Alternative Catalog Number: BYT-ORB2142734-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ZNF883
Conjugation: Biotin
ZNF883 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 001094808
UniProt: P0CG24
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: YQCNECGKSFSLSSALTKHKRIHTRERPYQCTKCGDVFCHSTSLIRHQKT