GATA5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2142791
Article Name: GATA5 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2142791
Supplier Catalog Number: orb2142791
Alternative Catalog Number: BYT-ORB2142791-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human GATA5
Conjugation: Biotin
Alternative Names: CHTD5, GATAS, bB379O24.1
GATA5 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 41kDa
NCBI: 536721
UniProt: Q9BWX5
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SAATSKAKPSLASPVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFP