Lhx8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2142929
Article Name: Lhx8 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2142929
Supplier Catalog Number: orb2142929
Alternative Catalog Number: BYT-ORB2142929-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Rat Lhx8
Conjugation: Biotin
Alternative Names: Lhx7
Lhx8 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 36kDa
NCBI: 001012219
UniProt: Q5FVG3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MSEECGRPAALAAGRTRKGAGEEGLVNPEGAGDEDSCSSSAPLSPSSSPQ