DRAP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2143177
Article Name: DRAP1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2143177
Supplier Catalog Number: orb2143177
Alternative Catalog Number: BYT-ORB2143177-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DRAP1
Conjugation: Biotin
Alternative Names: NC2-alpha
DRAP1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 006433
UniProt: Q14919
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MPSKKKKYNARFPPARIKKIMQTDEEIGKVAAAVPVIISRALELFLESLL